PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016499259.1
Common NameMads111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 593aa    MW: 65856 Da    PI: 4.2753
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016499259.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.89.2e-161452745
                    HHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  7 snrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    snr   +s+R++g+lKKA+ELSvLCd+++ + +fs+ gk
  XP_016499259.1 14 SNRIGVYSRRKKGLLKKANELSVLCDIDIFLAMFSPGGK 52
                    788889******************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-17159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.311160IPR002100Transcription factor, MADS-box
CDDcd002662.58E-16284No hitNo description
SuperFamilySSF554551.44E-18394IPR002100Transcription factor, MADS-box
PfamPF003193.2E-141456IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-82237IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-83758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MGRAKLKLHK LDGSNRIGVY SRRKKGLLKK ANELSVLCDI DIFLAMFSPG GKPSVYKSDN  60
SSFEDMITTK FAEVNPEERA KRKMECLDTI KKACKKYDHD VDIGEQLCPG DLTTADINFL  120
SQSLRIRLSD IEGRLRLWKN LDKIDSIQQL RKLENSISKS LNEIAKHKCG MGSLIFGAGQ  180
DFQPSSARHG MDSPLNFDAR KELHPCSSVH ACDSENIDVN EGMNSFDSSL LCDTGQDFQT  240
TSLMQHGMNL GQELYQCSSV HGGNSENMDV YEDLNSFPLE YLEESSFSFE SYTNLVCNKE  300
IEVSMPESVN FVPDEIFLDC EVNQEDIVTD FGFTFDVPQL EQTDDQGNAF DYNINKGSRL  360
PHSDLVNIHD SSKSASGTCE KMILAKSLHF LYGMDSSSSD AGEEFSTASS IKHGINLSST  420
QLDAGLSVNG GDSENMDDYE DLNAFDSCLK FDDEHEFQSS SSIGHYSMNS PVSFDAGQEL  480
HRSSSVNGGD SESINGYGDL NLFVQGFLDD PSLSIESCTD LACNHEVENY KPGYENCSAD  540
KIFLDCQLNQ ENIEMAFKSN LDLPLVEQMD VQESTFDCLN KGFGFPLLTS ILV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1837210.0AY183721.1 Nicotiana tabacum MADS box protein (Mads1;11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016499254.10.0PREDICTED: uncharacterized protein LOC107817880
RefseqXP_016499255.10.0PREDICTED: uncharacterized protein LOC107817880
RefseqXP_016499257.10.0PREDICTED: uncharacterized protein LOC107817880
RefseqXP_016499258.10.0PREDICTED: uncharacterized protein LOC107817880
RefseqXP_016499259.10.0PREDICTED: uncharacterized protein LOC107817880
TrEMBLQ84KS10.0Q84KS1_TOBAC; MADS box protein
STRINGSolyc11g045310.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.22e-45AGAMOUS-like 30
Publications ? help Back to Top
  1. Steiner C,Bauer J,Amrhein N,Bucher M
    Two novel genes are differentially expressed during early germination of the male gametophyte of Nicotiana tabacum.
    Biochim. Biophys. Acta, 2003. 1625(2): p. 123-33
    [PMID:12531471]